PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA05G17790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 315aa    MW: 35932 Da    PI: 7.3234
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA05G17790.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.94.8e-27112162151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      krien++nrqvtfskRr+gilKKA E+ vLCdaev v+ifss gkl +y++
  ONIVA05G17790.1 112 KRIENSTNRQVTFSKRRAGILKKAREIGVLCDAEVGVVIFSSAGKLSDYCT 162
                      79***********************************************96 PP

2K-box58.23.6e-20174272197
            K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqR..hllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                      yq++sgk l+++k++sl+ e++++kke++n+q e+R  h++GedL+sL+ keL  +e++L+++  + R+k +++++++ ++ ++ e+e++    
  ONIVA05G17790.1 174 YQTNSGKILWDEKHKSLSAEIDRVKKENDNMQIELRlvHMKGEDLNSLQPKELIAIEEALNNGQANLRDKMMDHWRMHKRNEKMLEDEHKMLAF 267
                      79999999************************998888********************************998888888888888888777766 PP

            K-box  93 aLrkk 97 
                      + +++
  ONIVA05G17790.1 268 RVHQQ 272
                      66665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-39104163IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.469104164IPR002100Transcription factor, MADS-box
CDDcd002656.69E-41105183No hitNo description
SuperFamilySSF554557.85E-32105198IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-27106126IPR002100Transcription factor, MADS-box
PfamPF003195.2E-23113160IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-27126141IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-27141162IPR002100Transcription factor, MADS-box
PfamPF014867.8E-13185269IPR002487Transcription factor, K-box
PROSITE profilePS5129711.788187275IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MHHARERERE RAVSISGAPA LPHRESPPHL HSFHGDLPPP PPPLHPPLLL HSNHGVQSST  60
PPTIPTLKTG RTATPQPSCF FESEVKICFL VCVLGVEEEE ELDMGRGKIE IKRIENSTNR  120
QVTFSKRRAG ILKKAREIGV LCDAEVGVVI FSSAGKLSDY CTPKTTLSRI LEKYQTNSGK  180
ILWDEKHKSL SAEIDRVKKE NDNMQIELRL VHMKGEDLNS LQPKELIAIE EALNNGQANL  240
RDKMMDHWRM HKRNEKMLED EHKMLAFRVH QQEVELSGGI RELELGYHHD DRDFAASMPF  300
TFRVQPSHPN LQQEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-17104189178Myocyte-specific enhancer factor 2B
1tqe_Q3e-17104189178Myocyte-specific enhancer factor 2B
1tqe_R3e-17104189178Myocyte-specific enhancer factor 2B
1tqe_S3e-17104189178Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankRICOSMAA0.0L37527.1 Oryza sativa MADS box protein (MADS4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640709.11e-153PREDICTED: MADS-box transcription factor 4 isoform X1
SwissprotQ407031e-152MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBLA0A0E0HEP30.0A0A0E0HEP3_ORYNI; Uncharacterized protein
STRINGBGIOSGA019900-PA1e-152(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.17e-71MIKC_MADS family protein